PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_09318
Common NameKK1_009582
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 339aa    MW: 37901.6 Da    PI: 7.8739
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_09318genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.4e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+ +++++G+g +W + ++++g++R++k+c++rw++yl
    C.cajan_09318 14 KGPWSPEEDAKLKSYIEKHGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding38.72.3e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
    C.cajan_09318  69 GGFSEEEDNIICSLYISIGSR-WSVIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.118966IPR017930Myb domain
SuperFamilySSF466896.13E-2711109IPR009057Homeodomain-like
SMARTSM007173.8E-131364IPR001005SANT/Myb domain
PfamPF002493.9E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-251569IPR009057Homeodomain-like
CDDcd001674.63E-101662No hitNo description
SMARTSM007172.9E-1167115IPR001005SANT/Myb domain
PROSITE profilePS5129416.25767117IPR017930Myb domain
PfamPF002495.0E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-2370117IPR009057Homeodomain-like
CDDcd001672.29E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAKLKSYIE KHGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDNIIC SLYISIGSRW SVIAAQLPGR TDNDIKNYWN TRLKKKLLGK  120
HRKELQARNK GNSVVKQENN NSSLLLQENS AQLQPCWPVL PLSPYTNQTP SFNDQDSIRK  180
LLIKLGGRFS GDYQPILDGL NNIQFSQQIQ EEQVHVGSSG CMNSIGNNNQ VQFGQSNNEY  240
CAELVQGQGT FTAAIGEMVS TNNDYSQRLL GGLEFFYGEE MITDKIVSGS SSCEQISTNW  300
GETSSLMYPP LVASNYEGVR QEMPRDCAFQ ELSYLGAPQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150351e-103AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007136795.10.0hypothetical protein PHAVU_009G075000g
SwissprotQ9M2Y91e-88RAX3_ARATH; Transcription factor RAX3
TrEMBLA0A151TTL80.0A0A151TTL8_CAJCA; Transcription factor RAX3
STRINGGLYMA06G05260.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.12e-78myb domain protein 84